Multiple issues notability September 2009 primarysources September 2009 refimprove September 2009 Infobox album See Wikipedia WikiProject Albums Name Lemonade Type studio Artist Mucky Pup Cover Lemonade Mucky Pup album .jpg Alt Released 1992 Recorded 1991 Genre Length Label Century Media Records Century Media Producer Reviews Last album Act of Faith album Act of Faith br 1990 This album Lemonade br 1992 Next album Lemonade is the fifth studio album by Mucky Pup . ref cite web url http www.muckypup.com content discography title Discography publisher MuckyPup.com date 2009 04 11 accessdate 2012 02 27 ref Released in 1992, the album saw the band take a turn away from humorous crossover thrash and Hardcore punk hardcore songs to focus on more aggressive, emotional and angry songs. The album also brought another lineup change to the band as John Milnes moved from drums to guitar and Kevin Powers took over the drummer s position. It also saw the return of bassist, Marc DeBacker who had last performed with the band on the Now Mucky Pup album Now album, released in 1989. The album features an unlisted cover of Billy Bragg s song, The Only One as a hidden bonus track. A video was made for the song Own Up For What You Say. Tracks Own Up For What You Say Junkie Eyes Three Sides Beautiful People Mountain Song The TVs On Fire Deja Vu Two Little Men If Wishes Were Fishes Confessions Mountain Song 2 Darkwave Sleeps The Only One originally by Billy Bragg Line up Chris Milnes Vox, Guitar John Milnes Guitar Marc D. Baker Bass Kevin Powers Drums References Reflist MuckyPup Category 1992 albums Category Mucky Pup albums ... more details
Pup ca.1936 center Image BuhlPupInFlight.jpg center Buhl Pup ca.1936 center Image BuhlPup 1936 5 TedLowe JoePawlicki.jpg center Lowe & Pawlicki w Pup 5 36 center gallery http www.flickr.com search ... Bull Pup Category United States sport aircraft 1930 1939 Category Propeller aircraft Category Single ... more details
Multiple issues tone March 2009 refimprove March 2009 Infobox television show name A Pup Named Scooby Doo image File Pup named scooby doo.jpg 240px caption The main title card genre Comedy br Adventure ... 30 list episodes List of A Pup Named Scooby Doo episodes preceded by The 13 Ghosts of Scooby Doo followed by What s New, Scooby Doo? website A Pup Named Scooby Doo is the eighth incarnation of the Hanna ... guys in masks and costumes. The biggest difference was the tone of the show With A Pup Named Scooby ... flashback to Velma s fifth birthday, using the character designs from A Pup Named Scooby Doo ... action film Scooby Doo The Mystery Begins retcons A Pup Named Scooby Doo out of existence, establishing ... as Jenkins. Episodes main List of A Pup Named Scooby Doo episodes Home Media Release Warner Home Video initially released all 30 episodes of A Pup Named Scooby Doo on DVD in Region 1 ... wikitable DVD Name Ep Release Date Volume 1 ref cite web url http www.amazon.com Pup Named Scooby Doo Vol dp B00097DY3Y ref sr 1 5?s movies tv&ie UTF8&qid 1322665082&sr 1 5 title A Pup Named Scooby Doo ... web url http www.amazon.com Pup Named Scooby Doo Vol dp B00097DY48 ref sr 1 10?s movies tv&ie UTF8&qid 1322665082&sr 1 10 title A Pup Named Scooby Doo, Vol. 2 Casey Kasem, Don Messick, Christina Lange ... align center 4 July 19, 2005 Volume 3 ref cite web url http www.amazon.com Pup Named Scooby Doo Vol dp B000F7CMCM ref sr 1 8?s movies tv&ie UTF8&qid 1322665082&sr 1 8 title A Pup Named Scooby Doo, Vol ... 4 July 18, 2006 Volume 4 ref cite web url http www.amazon.com Pup Named Scooby Doo Vol dp B000F7CMCW ref sr 1 13?s movies tv&ie UTF8&qid 1322665309&sr 1 13 title A Pup Named Scooby Doo, Vol. 4 Scott Menville ... Volume 5 ref cite web url http www.amazon.com Pup Named Scooby Doo Vol dp B000ION258 ref sr 1 9?s movies tv&ie UTF8&qid 1322665082&sr 1 9 title A Pup Named Scooby Doo, Vol. 5 Scott Menville, Jackie ... cite web url http www.amazon.com Pup Named Scooby Doo Vol dp B000MTEFOG ref sr 1 7?s movies tv&ie UTF8 ... more details
Infobox film name Air Bud World Pup image air bud world pup poster.jpg caption French Movie Poster showing Air Bud 3 in the title. director Bill Bannerman producer Ian Fodie writer Mike Whiting br Robert Vince br Anne Vince br Paul Tamasy characters br Aaron Mendelsohn characters br Kevin DiCicco character Air Bud starring Kevin Zegers br Dale Midkiff br Caitlin Wachs br Chilton Crane br Brittany Paige Bouck br Shayn Solberg br Miguel Sandoval br Chantal Strand cinematography Cyrus Block editing Kelly Herron br Laura Mazur music Brahm Wenger distributor Walt Disney Home Video br Miramax Films Miramax Home Entertainment released December 12, 2000 runtime 83 min. language English Air Bud World Pup known as Air Bud 3 in most International countries is the third film in the Air Bud series. Plot Teenager Josh Framm s mother, Jackie, has just married her veterinarian boyfriend, Patrick Sullivan. Josh and his best friend, Tom Stewart, have just made their school s football soccer soccer team when their coach reveals that their team will become co ed. Josh meets Emma, an attractive girl who just moved with her family from England and not only will she be playing on his soccer team, but she also has a golden retriever named Molly. Molly quickly has puppies with Josh s basketball and football playing dog, Buddy. Next, it is discovered that Buddy also has the uncanny ability to play soccer. Buddy has a uniform and is on the roster, leading Josh s soccer team to the state championship. However, trouble occurs when Buddy s six newborn puppies are Kidnapping kidnapped by two people who want to sell them for cash. Film location This movie was filmed in Vancouver, British Columbia, Canada. The soccer field and red brick buildings in the background are part of Shaughnessy Elementary School ... cg avg.dll?p avg&sql 1 210953 Air Bud World Pup at Allmovie The Air Bud Series Category Sequel films ... Pup ... more details
Infobox Film name Fatty s Plucky Pup image image size caption director Roscoe Arbuckle Fatty Arbuckle producer Mack Sennett writer narrator starring Roscoe Arbuckle Fatty Arbuckle music cinematography editing distributor Keystone Studios released 28 June 1915 runtime 23 minutes country Film US language Silent film Silent br English language English intertitles budget preceded by followed by Fatty s Plucky Pup is a 1915 in film 1915 Short subject short comedy film directed by and starring Roscoe Arbuckle Fatty Arbuckle . A print of the film survives. ref name silentera cite web url http www.silentera.com PSFL data F FattysPluckyPup1915.html title Progressive Silent Film List Fatty s Plucky Pup accessdate 2008 11 15 work Silent Era ref Plot Fatty plays a somewhat lazy young man who disrupts his mother s life by causing a fire by smoking in bed, then ruins laundry day by dropping it in the mud. He has two loves of his life, the girl next door Lizzie and his dog Luke. After showcasing his lack of talents helping his mother, he is able to save Luke from the dog catchers and express his love for Lizzie through a hole in the fence. In the second reel, Fatty, Lizzie, mom and Luke go to the amusement park, where Fatty is first outwitted by a couple of sharks but then retrieves his losses by pointing a fake gun at them. To extract revenge, they kidnap Lizzie with the help of the embittered dog catchers, and take her to an abandoned shack, where they tie her to a post with a gun attached to a timer pointed at her head. Plucky pup Luke follows the crooks, and is able to warn Fatty in time to perform the last minute rescue, with the help of the Keystone Cops. In the closing shot Fatty, Lizzie and Luke embrace in a joint kiss and lick . Cast Roscoe Arbuckle Roscoe Fatty Arbuckle Fatty Phyllis Allen Fatty s mother Joe Bordeaux Kennedy s partner Luke the Dog Luke Edgar Kennedy Shell game ... reflist External links imdb title id 0005315 title Fatty s Plucky Pup Category 1915 films Category 1910s ... more details
Unreferenced date December 2009 Orphan date February 2009 Emil Pup Pupulidy 1908 in Greece 1996 in Florida built and raced Porsche s automobile s and motorcycle s in the 1950s and 1960s. Early life Since his birth Pupulidy had a difficult life. When he was only four years old his father committed suicide. Shortly after his father s death his mother moved the family to America and forced Emil to Dropping out drop out of school. He worked until he was 16 to support his mother and two sisters. Military service When he was in his thirties, Pupulidy fought in World War II . He worked on repairing bridges and was one of the first troops in Auschwitz after the Nazism Nazis had been defeated. Racing After he returned from World War II Pupulidy became very interested in building and racing cars. In 1958 he won the Europa Berg Meister race in the Gran Turismo Meister 1600 in a Porsche which he had built. Around that time he also traveled all around Europe and Africa in a Volkswagen van with three other men. Family life Once in his late forties he started a stained glass company and married one of his employees, Doris Pupulidy, who was in her thirties and had a daughter from a previous marriage named Leslie. Together Emil and Doris settled in Long Island and had a child named Susan. When they retired they moved to Florida, where Pupulidy died in 1996. Persondata Metadata see Wikipedia Persondata . NAME Pupulidy, Emil Pup ALTERNATIVE NAMES SHORT DESCRIPTION DATE OF BIRTH 1908 PLACE OF BIRTH DATE OF DEATH 1996 PLACE OF DEATH DEFAULTSORT Pupulidy, Emil Pup Category 1908 births Category 1996 deaths Category American racing drivers Category American people of Greek descent ... more details
Infobox Hollywood cartoon cartoon name Slicked up Pup series Tom and Jerry image Slicked Up Pup Title.JPG caption director William Hanna br Joseph Barbera story artist William Hanna br Joseph Barbera animator Ed Barge br Kenneth Muse br Irven Spence br Ray Patterson voice actor Daws Butler musician Scott Bradley producer Fred Quimby distributor Metro Goldwyn Mayer release date September 8, 1951 color process Technicolor runtime 6 19 movie language English language English preceded by His Mouse Friday followed by Nit Witty Kitty Slicked up Pup is a 1951 American one reel animated cartoon and is the 60th Tom and Jerry cartoon directed by William Hanna and Joseph Barbera and produced by Fred Quimby . The cartoon was scored by Scott Bradley and animated by Ed Barge, Kenneth Muse, Irven Spence and Ray Patterson. ref cite book last Library of Congress. Copyright Office first title Catalog of copyright entries url http books.google.com books?id CrjnAAAAMAAJ&q 22slicked up pup 22&dq 22slicked up pup 22&hl en&ei GjlkTPnZJIbVngeeiqyVDQ&sa X&oi book result&ct result&resnum 7&ved 0CEcQ6AEwBg year 1951 publisher U.S. Govt. Print. Off. page 118 ref It features the second appearance of both Spike and Tyke together. Plot Spike has just bathed Tyke so that he is nice and clean. However, Spike is horrified when, through the constant chases of Tom and Jerry, Tyke ends up getting dirty by falling into a muddy puddle. Spike grabs Tom and scolds him that if Tyke isn t clean at all, the feline will be in trouble with the law. Tom quickly rushes off with the muddy pup and returns almost instantly with Tyke cleaned up. Tom grudgingly agrees to look after the pup and ensure his cleanliness until Spike returns, Jerry of course being ready to sabotage this. As Tom sits down on the same wooden platform that Tyke is lying on, one of the wooden planks catapults Tyke into the air, and Tom narrowly saves ... in front of the pup so that the tomato does hit him after all. The chase resumes until Tyke ends up ... more details
, the Sky Pup is a single seater designed as an FAR 103 Ultralight Vehicles compliant aircraft ... wood. The Sky Pup can be built with an open cockpit or fully enclosed, allowing flying in cooler weather. The Sky Pup is available as plans only. The power range specified is convert 18 to 28 hp kW ... skypup.wikispaces.com Specifications title Sky Pup Specifications accessdate 13 January 2011 last ... Variants Units using this aircraft Operators choose Specifications Sky Pup Aircraft specs ref Cliche ... file view IM001027.JPG 34774157 IM001027.JPG Photo of a Sky Pup Aviation lists Category United ... more details
Infobox Aircraft Begin name N3 Pup logo ONLY for an individual logo of the aircraft model, NOT the main manufacturer logo image File Preceptor N3 Pup.jpg caption Preceptor N 3 Pup Infobox Aircraft Type type homebuilt aircraft Kit aircraft manufacturer Preceptor Aircraft designer Bob Counts first flight if it hasn t happened, leave it out introduction date the aircraft entered or will enter military or revenue service retired date the aircraft left military or revenue service. If vague or multiples, it probably should be skipped status in most cases, this field is redundant use it sparingly primary user Private owners more users limited to three more users total please separate with br produced years in production, e.g. 1970 1999, if still in active use but no longer built number built 1087 ... with their own articles variants OF the topic type The N3 Pup , is a family of ultralight, tube ... Pup can accept various lightweight 4 cycle engines of between convert 37 and 60 hp kW 0 abbr on . If built ... and development The Pup is designed to be flown cross country and also can be mounted with floats and skis. ref name Cliche The N3 Pup uses tube and fabric construction and a conventional 4 cycle engine ... engine marketed for the Pup. The aircraft is sold as partially prefabricated kits or can be built scratchbuilt ... history A N3 Pup modified to look like a American Champion Citabria Citabria named Citabriette ... Preceptor Ultra Pup.jpg 225px right thumb Ultra Pup N3 Pup Single seat variant designed to resemble a 3 4 scale Piper J 3 Cub . Originally named the Nostalgair N 3 Pup. Engine is a TEC Half VW of convert ... ref name KitplanesDec1998 ref name Aerocrafter Super Pup Single seat variant with larger ... ref name KitplanesDec1998 ref name Aerocrafter Ultra Pup Two seat variant based on the Piper J 3 Cub ... Aerocrafter Specifications N3 Pup Aircraft specs ref Manufacturer s website ref name site cite web url http www.preceptoraircraft.com n3pup.html title N3 Pup work Preceptor Aircraft accessdate 2010 ... more details
Unreferenced date May 2008 Infobox Hollywood cartoon cartoon name Hic cup Pup series Tom and Jerry image Hic cuppuptitle.jpg caption Title Card director William Hanna br Joseph Barbera story artist William Hanna br Joseph Barbera animator Ed Barge br Kenneth Muse br Ray Patterson animator Ray Patterson br Irven Spence producer Fred Quimby background artist Robert Gentle voice actor Daws Butler musician Scott Bradley distributor Metro Goldwyn Mayer release date April 17, 1954 color process Technicolor runtime 6 17 movie language English language English preceded by Posse Cat followed by Little School Mouse Hic cup Pup is the 82nd one reel animated cartoon animated Tom and Jerry Short subject short , created in 1952 in film 1952 directed by William Hanna and Joseph Barbera and produced by Fred Quimby with music by Scott Bradley. The cartoon was animated by Ed Barge, Kenneth Muse, Ray Patterson and Irven Spence with backgrounds by Robert Gentle. It and was released in theaters on April 17, 1954 in film 1954 by Metro Goldwyn Mayer . Plot Plot date January 2010 Spike and Tyke characters Spike is putting his son, Tyke, to bed. When a chirping canary flies by, Spike calmly tells the canary to be quiet. However, Tom and Jerry s usual antics wake Tyke up, and Spike asks Tom Hey, What s the big idea of waking up my boy? , but the puppy gets the hiccups . Spike is understandably annoyed by both the noise and hiccups and explains that every time he wakes up disturbed from his nap, he gets the hiccups. Spike threatens Tom, placing responsibility on Tom to keep quiet. Jerry immediately bites Tom s tail, who screams startledly in pain, waking up Tyke a second time. With all the blame on him, the cat flees each successive hiccup from Tyke pushes him another couple inches into the air before Spike pats him on the back. Tom peeks around the corner and Jerry pops his head out of a flower ... mouth , runs away in fear. Spike tends to the hiccuping pup by giving him water, scaring him and popping ... more details
Primarysources date April 2012 Infobox Organization name File PUPLogotype.png 300px br small Center for Culture and the Arts small image size 225px caption map msize mcaption abbreviation PUP UCCA motto Tanglaw ng Bayan formation 1974 type Non profit cultural center status purpose Cultural Groups and Services headquarters Santa Mesa, Manila Santa Mesa , Manila location Philippines region served membership language leader title Director leader name Prof. Segundo C. Dizon main organ parent organization affiliations num staff num volunteers budget website http www.pup.edu.ph ovpss ucca remarks File PUPLogotype.png 300px The PUP Center for Culture and the Arts UCCA is affiliated with the Polytechnic University of the Philippines . ref name ucca http www.pup.edu.ph StudentServices ucca University Center for Culture and the Arts , Polytechnic University Website, Retrieved 16 October 2011 ref References Reflist PUP coord 14 35 52 N 121 00 35 E display title Category Polytechnic University of the Philippines Philippines stub ... more details
DISPLAYTITLE List of A Pup Named Scooby Doo episodes The following contains a list of episodes from the United States American animation animated television series A Pup Named Scooby Doo which ran on ABC from 1988 until 1991. This was the eighth incarnation of the long running Scooby Doo Saturday morning series following the Scooby Doo Detective Agency s adventures as adolescents. Series overview class wikitable style padding 0 8px rowspan 2 Season style padding 0 8px rowspan 2 Episodes style padding 0 80px colspan 2 Originally aired U.S. dates Season premiere Season finale style background ccf color 100 text align center List of A Pup Named Scooby Doo episodes Season 1 1985 1 style text align center 13 style text align center Start date 1988 9 10 style text align center End date 1988 12 10 style background ccf color 100 text align center List of A Pup Named Scooby Doo episodes Season 2 1989 2 style text align center 8 style text align center Start date 1989 9 9 style text align center End date 1989 11 4 style background ccf color 100 text align center List of A Pup Named Scooby Doo episodes Season 3 and 4 1990 1991 3 and 4 style text align center 9 style text align center Start date ... Special replaced A Pup Named Scooby Doo on ABC s Saturday morning lineup. The final three first run episodes were not run until August, 1991. When released on DVD in complete season sets A Pup Named ... web url http www.amazon.com Pup Named Scooby Doo Complete Season dp B000ZIZX54 ref sr 1 1?s movies tv&ie UTF8&qid 1322665082&sr 1 1 title A Pup Named Scooby Doo Complete 1st Season Casey Kasem, Don ... date accessdate 2011 11 30 ref while the final season was split into two to make A Pup Named Scooby ... episodes. ref cite web url http www.amazon.com Pup Named Scooby Doo Complete Seasons dp B001O2UTTK ref sr 1 2?s movies tv&ie UTF8&qid 1322665082&sr 1 2 title A Pup Named Scooby Doo Complete 2nd ... series episodes Pup Named Scooby Doo, A it Episodi de Il cucciolo Scooby Doo ... more details
Players can be labeled Physically Unable to Perform PUP in the National Football League if they suffer from football related injuries during the preseason. PUP players may participate in team meetings, and take advantage of the training and medical facilities, but cannot practice with the team. There are two separate PUP lists a preseason PUP list and a regular season PUP list. Preseason PUP A player who, as a result of football related injuries, is unable to take part in training camp practices may be assigned to the preseason PUP list. Players can be moved off the PUP list to the active roster at any time, even after one practice. A player cannot be placed on the PUP list, however, once he has taken the field for a practice, even if only for a few minutes. Regular Season PUP A player who finishes the preseason still on the PUP list can then be placed on the regular season PUP list. Such players must sit out the first six games their team plays. At that point, teams have a three week window in which to allow the player to begin practicing from the day the player begins practicing, teams have an additional three week window in which to decide whether to activate the player to the 53 man roster. If either of those deadlines pass, the player must remain on the PUP list for the remainder of the season. ref cite news title Hurt? What Injured Players Need to Know url http www.nflplayers.com Articles Public News Hurt What Injured Players Need to Know work nflplayers.com date June 3, 2008 accessdate 2010 10 11 ref Non Football Injury A similar list, known as the Non Football Injury NFI list, is functionally equivalent to PUP, but is used for players who are unable to practice as a result of conditions unrelated to football. For example, New England Patriots tackle Marcus Cannon began his rookie season on the NFI list as he recovered from chemotherapy for non Hodgkin lymphoma . See also Injured reserve list References Reflist Category National Football League ball sports stub ... more details
Infobox Company company name Preceptor Aircraft company logo File Preceptor Aircraft Logo.png 200px company type Private company Private foundation location Rutherfordton, North Carolina key people Bob Counts industry Aerospace products Homebuilt aircraft revenue operating income slogan net income num employees parent divisions subsid homepage http www.preceptoraircraft.com www.preceptoraircraft.com footnotes Preceptor Aircraft is an United States American aircraft kit manufacturer located in Rutherfordton , North Carolina , producing kits for homebuilt monoplane s. The company was previously named Nostalgair. Aircraft File Preceptor Ultra Pup.jpg 225px right thumb Ultra Pup Preceptor STOL King STOL King , A high wing STOL aircraft. ref name STOL King cite web url http www.preceptoraircraft.com stolking.html title STOL King accessdate 2010 04 20 last year 2010 ref Preceptor Ultra Pup Ultra Pup , A 2 seat high wing aircraft. ref name Ultra Pup cite web url http www.preceptoraircraft.com ultrapup.html title Ultra Pup accessdate 2010 04 20 last year 2010 ref Preceptor Super Pup Super Pup , A 1 seat experimental high wing aircraft. ref name Super Pup cite web url http www.preceptoraircraft.com superpup.html title Super Pup accessdate 2010 04 20 last year 2010 ref Preceptor N3 Pup N3 Pup , A 1 seat ultralight high wing aircraft. ref name N3 Pup cite web url http www.preceptoraircraft.com n3pup.html title N3 Pup accessdate 2010 04 20 last year 2010 ref History Preceptor Aircraft was originally called Nostalgair and based in San Antonio, Texas . Preceptor N3 Pup N3 Pup construction was farmed out to a Colorado interest. Nostalgair and its sister company Global tool maker of Gloabal engines went out of business in 1986. Warren Mosler purchased the assets and placed Bob Counts, designer of the N3 Pup as president. Production moved to Winston Salem, North Carolina . ref Cite journal title Li L OL SMOOTHIE...THE MOSLER ENGINE magazine Sport Avaiation pp 57 date April 1989 ref ... more details
Prokaryotic ubiquitin like protein Pup functional analog of ubiquitin found in prokaryote Mycobacterium tuberculosis . ref name Pup paper Cite pmid 18832610 ref Serves the same function, although the enzymology of ubiquitylation and pupylation is different. In contrast to the three step reaction of ubiquitylation, pupylation requires two steps, therefore only two enzymes are involved in pupylation. Similar to ubiquitin, Pup attaches to specific lysine residues of substrate proteins by forming isopeptide bonds to target the proteins for proteasomal degradation. Therefore, like eukaryotes, bacteria may use a small protein modifier to control protein stability. Pfam box Symbol Pup Name Pup like protein family image Pup prokaryotic ubiquitin like protein.png width 375px caption Three Prokaryotic ubiquitin like proteins blue attached to proteasomal ATPase Mpa red Pfam PF05639 InterPro SMART EntrezGene EU914921 Prosite SCOP TCDB OPM family OPM protein PDB PDB2 3M91 , PDB2 3M9D Pup gene encode a 64 amino acid protein with a molecular size of 6.944 Atomic mass unit kDa align left style border color 338899 border style solid border width 2px margin top 1em MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ clear References reflist See also Ubiquitin SUMO protein Category Proteins ... more details
schooldis The Polytechnic University of the Philippines is a State university and college Philippines state university system in the Philippines. This may refer to different educational institutions, such as Polytechnic University of the Philippines Polytechnic University of the Philippines, Manila main and flagship campus Polytechnic University of the Philippines Laboratory High School PUP s branch campuses Polytechnic University of the Philippines, Taguig Polytechnic University of the Philippines, Commonwealth Polytechnic University of the Philippines, San Juan Polytechnic University of the Philippines, Lopez Polytechnic University of the Philippines, Bataan Polytechnic University of the Philippines, Maragondon Polytechnic University of the Philippines, Mulanay Polytechnic University of the Philippines, Unisan Polytechnic University of the Philippines, Ragay Polytechnic University of the Philippines, Santa Rosa Polytechnic University of the Philippines, San Pedro Polytechnic University of the Philippines, Santo Tomas Polytechnic University of the Philippines, Santa Maria Polytechnic University of the Philippines, Pulilan PUP s distance learning university Polytechnic University of the Philippines, Open University PUP s defunct campus Polytechnic University of the Philippines, Technical School at Lepanto PUP PUP Locations ... more details
proves to be too small for the pup s head. Jerry then lets him into the house, where the pup laps some of Tom s milk. Jerry hides the pup before Tom wakes up, imitates the pup, and runs off. Tom chases Jerry, but soon finds that the pup is lapping his milk. Tom cannot stop the pup from drinking his milk, and when Tom confronts the pup, he gets a licking. Tom puts the pup outside, but Jerry scoops him up and puts him in a drawer. Once Jerry is down from the stool he was on, he sees the pup ... after he finds his blanket is missing. Tom pokes the pup and gets licked again. Tom takes the blanket and throws the pup outside, where it falls into a bottle. Jerry uses the windowsill string to free him and gets licked in the process, but is met by Tom soon after. Jerry presents the pup and he licks Tom again. Tom chases Jerry, who is holding the pup, around the kitchen, until he trips them up ... thunderstorm and he believes he is a skunk Stinker when he mercilessly kicked out both the mouse and pup ... both Jerry and the pup are possibly being washed away by flood water at the river. Tom then gets worried about this and ventures out in the thunderstorm to find Jerry and the pup. His whistling wakes up the pup who was sleeping safely in a storm drain together with Jerry but gets caught by wind nearly drowning in the river and yelping in distress. Jerry and the pup come to Tom s rescue. Together Jerry and the pup drag Tom out of the river. Image Puppy Tale 2.JPG thumb 200px right The puppy invites ... and give the pup his own bed and a bowl of milk. The puppy calls for his siblings and they all share ... more details
The PARC Universal Packet commonly abbreviated to PUP , although the original documents usually use Pup ... PARC in the mid 1970s. Technically, the name PUP only refers to the internetwork level protocol, but it is also .... History The origins of the PUP suite lie in two developments in the same events in the early 1970s ... of the Ethernet local area network at PARC. However, the development of PUP split off because Xerox PARC wished to move ahead with implementation, for in house use. The fundamental design of the PUP suite was substantially complete by 1974. In the 1980s Xerox used PUP as the base for the Xerox ... Datagram Protocol were lightly modified versions of the ones in the PUP suite, but others are quite different, reflecting the experience gained with PUP and IP. Basic internetwork protocol This section is linked from Xerox Network Systems The main internetwork layer Network protocol protocol was PUP, which roughly corresponds to the Internet Protocol IP layer in TCP IP. A full PUP network address ... know their network number. Unlike TCP IP, socket fields were part of the full network address in the PUP header, so that upper layer protocols did not need to implement their own demultiplexing PUP also ... information technology packet . PUP packets were up to 554 bytes long including the 20 byte PUP ... support them individual PUP host pairs on a particular network might use larger packets, but no PUP ... protocol , and for hosts to discover routers. PUP also included a simple echo protocol at the internetwork ... for the equivalent protocol in XNS, Sequenced Packet Protocol . Application protocols PUP ..., PUP was very influential. However, its biggest impact was probably as a key component of the office ..., Pup Specifications Xerox Parc, Palo Alto, June, 1978 and October, 1975 Edward A. Taft, State Machine ... A. Taft, Naming and Addressing Conventions for Pup Xerox Parc, Palo Alto, July, 1978 and October, 1975 Edward A. Taft, Pup Error Protocol Xerox Parc, Palo Alto, July, 1978 and October, 1975 Jon A. Hupp ... more details
web title PUP iApply System Course Preferences url http iapply.pup.edu.ph S ybpba5voz4tnwb55c1lasc45 Step03.aspx work Polytechnic University of the Philippines publisher PUP WebSite Xentrius accessdate ... ref name pupnewssablayan cite web title PUP Sablayan Campus Pioneers url http ilovemindoro.blogspot.com 2011 01 pup sablayan campus pioneers.html work Let s Adventure to Mindoro accessdate 28 November ... Website PUP References reflist Category Polytechnic University of the Philippines ... more details
A91 or A 91 may refer to A91 road Scotland Dutch Defence , in the Encyclopaedia of Chess Openings A 91 , a Russian bull pup assault rifle, derived from the 9A 91 carbine Letter NumberCombDisambig de A91 fr A91 it A91 nl A91 ... more details
Unreferenced date December 2009 Image Pupportugal.png frame left Image 86 republicapopular.PNG thumb PUP poster Popular Unity Party in Portuguese language Portuguese Partido de Unidade Popular was a political party in Portugal . PUP was founded in December 1974 by the Mendes fraction of the Communist Party of Portugal Marxist Leninist . After the 1975 elections PUP was renamed Portuguese Marxist Leninist Committee Comit Marxista Leninista Portugu s . In 1976 CMLP merged with the Portuguese Marxist Leninist Communist Organization and the Organization for the Reconstruction of the Communist Party Marxist Leninist to form the Portuguese Communist Party Reconstructed . Category Communist parties in Portugal Category Defunct political parties in Portugal gl Partido da Unidade Popular Portugal pl Ludowa Partia Jedno ci Portugalia pt Partido de Unidade Popular ... more details
on February 11, 2008. However, effective March 30, 2008, he stepped down as PUP Leader and effectively ... Walk. Briceno resigned as PUP Leader on October 7, 2011, and as Opposition Leader on October 18, 2011, citing health issues. The PUP were without a leader in the House up to November 3, 2011, when ... more details
File PUP NALLRC.jpg thumb right 220px Ninoy Aquino Learning Resources Center The Ninoy Aquino Learning Resources Center NALRC , or the Polytechnic University of the Philippines Main Library is located at the Polytechnic University of the Philippines, Manila . Aside from being the university athenaeum, it is also the home of the University s College of Law and Department of Library and Information Science of the College of Arts. External links http www.pup.edu.ph ovpssea NALLRC PUP Ninoy Aquino Library and Learning Resources Center official website PUP coord 14 35 52 N 121 00 35 E display title Category Polytechnic University of the Philippines Category Libraries in the Philippines Philippines stub ... more details
will be challenged by the PUP s Rosalind Casey. Towns The slates for all district towns have been selected. Schedule February 4 Announcement of polls and nomination date. February 9 Presentation of PUP ... Mayor PUP 1739 25.84 Rosa Casanova Councilor PUP 1716 25.50 Miriam Gilharry Gomez Councilor UDP 1725 25.63 Raul Altamira Mai Councilor PUP 1759 26.14 Arcenio Vasquez Councilor PUP 1716 25.50 Miguel Ricalde Councilor PUP 1799 26.73 Tulio Rodriguez Councilor PUP 1720 25.56 Edward Head Henderson Mayor ... PUP 3392 34.13 Rozel Arana Flores Councilor PUP 3545 35.67 elected Rafael Avila Councilor PUP 3463 34.85 Kevin Bernard Councilor PUP 3499 35.21 elected Josue Carballo Councilor PUP 3531 35.53 elected Alexander Lopez Councilor PUP 3415 34.36 Faride Riverol Councilor PUP 3434 34.55 San Ignacio Santa Elena ... UDP 3664 36.24 elected Jose Hermilio Mendee MENDOZA Mayor PUP 1061 10.50 Nasim Elias Lisbey Councilor PUP 1448 14.32 Gabriel Jorge Benjy Maldonado Councilor PUP 1378 13.63 Jose Vicente Joe Marr Marr Sr. Councilor PUP 1471 14.55 Marleni Celene Guerra Torres Councilor PUP 1347 13.32 Yolla Asme Yolla Flores Vasquez Councilor PUP 1339 13.25 Luis Amett Cal Zaiden Councilor PUP 1367 13.52 Luis Ayala ... Pacheco Mayor PUP 539 13.98 Irma Araceli Garcia Councilor PUP 540 14.01 Kenny Giovani Luna Councilor PUP 568 14.73 Francisco Manuel Moya Portillo Councilor PUP 585 15.18 Luis Enrique Kike Quiroz Councilor PUP 578 14.99 Jose Luis Wicho Rodriguez Councilor PUP 547 14.19 Daisy Yacab Magana Councilor PUP ... more details
Encyclopedia
top
