Search: in
Ubiquitin B
Ubiquitin B in Encyclopedia Encyclopedia
  Tutorials     Encyclopedia     Videos     Books     Software     DVDs  
       
Encyclopedia results for Ubiquitin B

Ubiquitin B





Encyclopedia results for Ubiquitin B

  1. Ubiquitin B

    title Entrez Gene UBB ubiquitin B url http www.ncbi.nlm.nih.gov sites entrez?Db gene&Cmd ShowDetailView&TermToSearch ...PBB geneid 7314 Ubiquitin is a protein that in humans is encoded by the UBB gene . ref name pmid2154095 ... year 1990 month Mar pmid 2154095 pmc 1684968 doi ref Function Ubiquitin, one of the most conserved proteins known. Ubiquitin is required for Adenosine triphosphate ATP dependent, non lysosome lysosomal .... Ubiquitin is covalently bound to proteins to be degraded, and presumably labels these proteins for degradation. Ubiquitin also binds to histone H2A in actively transcribed regions but does not cause histone H2A degradation, suggesting that ubiquitin is also involved in regulation of gene expression. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence ... DF, De Vos RA, Van Dijk R, De Vrij FM, Proper EA, Sonnemans MA, Verhage MC, Sluijs JA, Hobo B ... ubiquitin as a marker for proteasomal dysfunction in the brain journal FASEB J volume 17 issue ... Conaway RC, Brower CS, Conaway JW title Emerging roles of ubiquitin in transcription regulation ... cite journal author Murphey RK, Godenschwege TA title New roles for ubiquitin in the assembly ... WJ last5 Varley first5 JM cite journal author Pancr V title Effect of ubiquitin on platelet functions ... PG title The human ubiquitin 52 amino acid fusion protein gene shares several structural features ..., Hollander MC, Lamoreaux E title Ubiquitin mRNA is a major stress induced transcript in mammalian cells ... human ubiquitin reveals that ubiquitin is synthesized as a precursor journal J. Biol. Chem. volume ... and sequence analysis of a cDNA encoding poly ubiquitin in human ovarian granulosa cells journal Biochem ... 291X 87 90970 3 cite journal author Wiborg O title The human ubiquitin multigene family some genes contain multiple directly repeated ubiquitin coding sequences journal EMBO J. volume 4 issue 3 pages ... author Baker RT, Board PG title The human ubiquitin gene family structure of a gene and pseudogenes ...   more details



  1. Ubiquitin

    6699CC Gene names style background 99CCFF RPS27A UBA80, UBCEP1 , UBA52 UBCEP2 , Ubiquitin B ... L40 and S27a, respectively. The Ubiquitin B UBB and Ubiquitin C UBC genes code for polyubiquitin ... protein APP . ref name pmid21852239 A frameshift mutation in ubiquitin B can result in a truncated ... SUMO1 SUMO2 SUMO3 SUMO4 TMUB1 TMUB2 UBA52 Ubiquitin B UBB Ubiquitin C UBC UBD UBFD1 UBL4 UBL4A ...Ubiquitin is a small Regulatory protein regulatory protein that has been found in almost all tissues ... protein recycling. Pfam box Symbol ubiquitin Name Ubiquitin family image Ubiquitin cartoon 2 .png width 375px caption A diagram of ubiquitin . The seven lysine sidechains are shown in orange. Pfam ... 1otr B 6 74 PDB3 1q0w B 6 74 PDB3 1wr1 A 6 74 PDB3 1aar B 6 74 PDB3 2d3g A 6 74 PDB3 1p3q U 6 74 PDB3 1wr6 E 6 74 PDB3 1yd8 V 6 74 PDB3 1wrd B 6 74 PDB3 1e0q A 6 17 PDB3 1v80 A 6 74 PDB3 1v81 A 6 74 PDB3 1uzx B 6 74 PDB3 1c3t A 6 74 PDB3 1nbf C 6 74 PDB3 1d3z A 6 74 PDB3 1xd3 D 6 74 PDB3 1yx5 B 6 74 PDB3 1s1q D 6 74 PDB3 1ubi 6 74 PDB3 1tbe A 6 74 PDB3 1f9j B 6 74 PDB3 1yx6 B 6 74 PDB3 2ayo B 6 74 PDB3 1ubq 6 74 PDB3 1fxt B 6 74 PDB3 1gjz A 6 51 PDB3 1q5w B 6 74 PDB3 1g6j A 6 74 PDB3 2bgf B 6 74 PDB3 1sif A 6 74 PDB3 1bt0 A 6 74 PDB3 1r4m J 6 74 PDB3 1ndd B 6 74 PDB3 1r4n J 6 74 PDB3 2bkr B 6 74 PDB3 1xt9 B 6 74 PDB3 1hx1 B 175 222 PDB3 1i6z A 226 232 PDB3 1wx9 A 22 89 PDB3 2bwe U 8 75 PDB3 ... A 15 89 PDB3 1u4a A 20 90 PDB3 1wz0 A 21 91 PDB3 2bzo B 21 91 PDB3 1wm2 A 21 89 PDB3 1wm3 A 21 88 PDB3 1tgz B 25 95 PDB3 1y8r F 25 95 PDB3 1z5s B 25 95 PDB3 2asq A 25 95 PDB3 1wyw B 25 95 PDB3 1a5r 25 95 PDB3 2bf8 B 25 95 PDB3 1l2n A 27 96 PDB3 1euv B 27 96 Ubiquitin can be attached to proteins and label them for destruction. The ubiquitin tag directs proteins to the proteasome , which is a large ... quote accessdate 2010 10 16 ref Ubiquitin tags can also direct proteins to other locations in the cell, where they control other protein and cell mechanisms. Identification Ubiquitin originally ...   more details



  1. Ubiquitin ligase

    enzyme Name Ubiquitin protein ligase EC number 6.3.2.19 CAS number 74812 49 0 IUBMB EC number 6 3 2 19 GO code 0051444 image 4a4c.png width caption E3 ubiquitin ligase Cbl blue in complex with E2 cyan and substrate peptide green . PDB entry PDBe 4a4c ref cite pmid 22266821 ref A ubiquitin ligase also called an E3 ubiquitin ligase is a protein that in combination with an E2 ubiquitin conjugating enzyme causes the attachment of ubiquitin to a lysine on a target protein via an isopeptide bond the E3 ubiquitin ligase targets specific protein substrates for degradation by the proteasome . In general, the ubiquitin ligase is involved in polyubiquitination A second ubiquitin is attached to the first ..., in which only a single ubiquitin is added by the ubiquitin ligase to a substrate molecule. Mono ... capable of binding ubiquitin. Citation needed date September 2011 Further complicating matters, different lysines on ubiquitin can be targeted by an E3 to make chains. The most common lysine is Lys48 on the ubiquitin chain. This is the lysine used to make polyubiquitin, which is recognized by the proteasome ..., among other functions. Overview In enzymology , an ubiquitin protein ligase EC number 6.3.2.19 is an enzyme that catalysis catalyzes the chemical reaction ATP ubiquitin protein lysine math rightleftharpoons ... are adenosine triphosphate ATP , ubiquitin , and protein lysine , whereas its 3 product ... D amino acid ligases peptide synthases . The systematic name of this enzyme class is ubiquitin protein lysine N ligase AMP forming . This enzyme is also called ubiquitin activating enzyme . This enzyme participates in 3 metabolism metabolic pathways ubiquitin mediated proteolysis , parkinson ... system The ubiquitin ligase is referred to as an E3, and operates in conjunction with an ubiquitin activating enzyme E1 ubiquitin activating enzyme and an ubiquitin conjugating enzyme E2 ubiquitin conjugating enzyme . There is one major E1 enzyme, shared by all ubiquitin ligases, that uses ...   more details



  1. Ubiquitin D

    B, Calistri A, Accola MA, et al. title A role for ubiquitin ligase recruitment in retrovirus release ... cite journal author Hipp MS, Kalveram B, Raasi S, et al. title FAT10, a ubiquitin independent signal ...PBB geneid 10537 Ubiquitin D is a protein that in humans is encoded by the UBD gene . ref name pmid9368598 cite journal author Bates EE, Ravel O, Dieu MC, Ho S, Guret C, Bridon JM, Ait Yahia S, Briere F, Caux C, Banchereau J, Lebecque S title Identification and analysis of a novel member of the ubiquitin family expressed in dendritic cells and mature B cells journal Eur J Immunol volume 27 issue 10 pages 2471 7 year 1997 month Dec pmid 9368598 pmc doi 10.1002 eji.1830271002 ref ref name pmid8662070 cite journal author Fan W, Cai W, Parimoo S, Schwarz DC, Lennon GG, Weissman SM title Identification of seven new human MHC class I region genes around the HLA F locus journal Immunogenetics volume 44 issue 2 pages 97 103 year 1996 month Aug pmid 8662070 pmc doi 10.1007 BF02660056 ref ref name entrez cite web title Entrez Gene UBD ubiquitin D url http www.ncbi.nlm.nih.gov sites entrez?Db gene&Cmd ... Marcus, Schmidtke Gunter year 2004 month Apr. title NEDD8 ultimate buster 1L interacts with the ubiquitin ... W, Collinge M, Bender J R, Weissman S M year 1999 month Apr. title A MHC encoded ubiquitin like protein ... 2006 pmid 16808324 doi cite journal author Ott DE, Coren LV, Copeland TD, et al. title Ubiquitin ... C, et al. title A MHC encoded ubiquitin like protein FAT10 binds noncovalently to the spindle ... 11112487 doi 10.1006 viro.2000.0648 cite journal author Strack B, Calistri A, G ttlinger HG title Late assembly domain function can exhibit context dependence and involves ubiquitin residues implicated ... for ubiquitin in Tat mediated transactivation of the HIV 1 promoter. journal Nat. Cell Biol. volume ... Hipp MS, Raasi S, Groettrup M, Schmidtke G title NEDD8 ultimate buster 1L interacts with the ubiquitin ..., Ozdamar B, et al. title High throughput mapping of a dynamic signaling network in mammalian cells ...   more details



  1. Ubiquitin C

    journal author Marinovic AC, Zheng B, Mitch WE, Price SR title Ubiquitin UbC expression in muscle cells ...PBB geneid 7316 Ubiquitin is a protein that in humans is encoded by the UBC gene . ref name pmid1315303 ... ref ref name entrez Cite web title Entrez Gene UBC ubiquitin C url http www.ncbi.nlm.nih.gov sites entrez ... title summary text Interactions Ubiquitin C has been shown to Protein protein interaction interact ..., Kellenberger Stephan, Staub Olivier year 2008 month Oct. title Vasopressin inducible ubiquitin ... with and is ubiquitinated by ubiquitin ligase ROC1 journal Biochem. Biophys. Res. Commun. volume ... year 2008 month Aug. title Ubiquitin chain editing revealed by polyubiquitin linkage specific antibodies ... last Conze first Dietrich B authorlink coauthors Wu Chuan Jin, Thomas James A, Landstrom Allison ... coauthors Deora Arunkumar B, Xiong Huabao, Ling Qi, Weksler Babette B, Niesvizky Ruben, Hajjar ... month May. title A tale of two Cbls interplay of c Cbl and Cbl b in epidermal growth factor receptor ... Jon, Gillard John W, Jaquith James B, Morris Stephen J, Barker Philip A year 2008 month Jun. title ... M year 2008 month May. title CARP 2 is an endosome associated ubiquitin ligase for RIP and regulates ... functions as a ubiquitin ligase for proliferating cell nuclear antigen polyubiquitination journal PNAS ... K, Aki M, et al. title Changes in expressions of proteasome and ubiquitin genes in human renal cancer ... author Baker RT, Board PG title Unequal crossover generates variation in ubiquitin coding unit number ... Cloning and sequence analysis of a cDNA encoding poly ubiquitin in human ovarian granulosa cells. journal ... ubiquitin multigene family some genes contain multiple directly repeated ubiquitin coding sequences ... Andersson B, Wentland MA, Ricafrente JY, et al. title A double adaptor method for improved shotgun ... B, Worley KC, et al. title Large scale concatenation cDNA sequencing. journal Genome Res. volume ... Ubiquitin is covalently attached to the p6Gag proteins of human immunodeficiency virus type 1 ...   more details



  1. Ubiquitin-conjugating enzyme

    enzyme Name Ubiquitin protein ligase EC number 6.3.2.19 CAS number 74812 49 0 IUBMB EC number 6 3 2 19 GO code 0051444 image width caption Pfam box Symbol UBQ conjugat E2 Name Ubiquitin conjugating enzyme, E2 Pfam PF00179 InterPro IPR000608 SMART SM00212 PROSITE PDOC00163 PDB PDB 1a3s PDB 1ayz PDB 1c4z PDB 1fbv PDB 1fxt PDB 1fzy PDB 1i7k PDB 1j74 PDB 1j7d PDB 1jas Ubiquitin conjugating enzymes , also known as E2 enzymes and more rarely as ubiquitin carrier enzymes , perform the second step in the ubiquitination reaction that targets a protein for degradation via the proteasome .The ubiquitination process covalent ly attaches ubiquitin , a short protein of 76 amino acid s, to a lysine residue on the target protein. Once a protein has been tagged with one ubiquitin molecule, additional rounds of ubiquitination form a polyubiquitin chain that is recognized by the proteasome s 19S regulatory particle, triggering the adenosine triphosphate ATP dependent denaturation biochemistry unfolding of the target protein that allows passage into the proteasome s 20S core particle, where protease s degrade ... A ubiquitin activating enzyme or E1 first activates the ubiquitin by covalently attaching the molecule to its active site cysteine residue. The activated ubiquitin is then transferred to an E2 cysteine. Once conjugated to ubiquitin, the E2 molecule binds one of several ubiquitin ligase s or E3s via ... the ubiquitin from the E2 cysteine to a lysine residue on the target protein. ref name Nandi cite ... The ubiquitin proteasome system journal Journal of biosciences volume 31 issue 1 pages 137 55 year ... title Protein interaction analysis of SCF ubiquitin E3 ligase subunits from Arabidopsis journal The Plant ... doi 10.1046 j.1365 313X.2003.01768.x ref Isozymes The following human genes encode ubiquitin conjugating ... gene UFC1 Div col end See also Ubiquitin Ubiquitin activating enzyme Ubiquitin ligase References Reflist External links ELM MOD SUMO MeshName Ubiquitin Conjugating Enzymes Ubiquitin conjugating enzymes ...   more details



  1. Ubiquitin?calmodulin ligase

    Orphan date November 2010 enzyme Name ubiquitin calmodulin ligase EC number 6.3.2.21 CAS number 119632 60 9 IUBMB EC number 6 3 2 21 GO code 0050372 image width caption In enzymology , an ubiquitin calmodulin ligase EC number 6.3.2.21 is an enzyme that catalysis catalyzes the chemical reaction n ATP calmodulin n ubiquitin math rightleftharpoons math n AMP n diphosphate ubiquitin n calmodulin The 3 substrate biochemistry substrates of this enzyme are adenosine triphosphate ATP , calmodulin , and ubiquitin , whereas its 3 product chemistry products are adenosine monophosphate AMP , diphosphate , and ubiquitin n calmodulin . This enzyme belongs to the family of ligase s, specifically those forming carbon nitrogen bonds as acid D amino acid ligases peptide synthases . The systematic name of this enzyme class is calmodulin ubiquitin ligase AMP forming . Other names in common use include ubiquityl calmodulin synthase , ubiquitin calmodulin synthetase , ubiquityl calmodulin synthetase , and uCaM synthetase . References reflist 1 cite journal doi 10.1515 bchm3.1988.369.2.1325 author Jennissen HP, Laub M year 1988 title Ubiquitin calmodulin conjugating activity from cardiac muscle journal Biol. Chem. Hoppe Seyler volume 369 pages 1325&ndash 30 pmid 2853950 issue 12 cite journal doi 10.1515 bchm3.1988.369.2.1317 author Ziegenhagen R, Jennissen HP year 1988 title Multiple ubiquitination of vertebrate calmodulin by reticulocyte lysate and inhibition of calmodulin conjugation by phosphorylase kinase journal Biol. Chem. Hoppe Seyler volume 369 pages 1317&ndash 24 pmid 2853949 issue 12 Category EC 6.3.2 Category Enzymes of unknown structure ligase stub ...   more details



  1. Ubiquitin-activating enzyme

    enzyme Name Ubiquitin protein ligase EC number 6.3.2.19 CAS number 74812 49 0 IUBMB EC number 6 3 2 19 GO code 0051444 image Ubiquitin activating enzyme bound to Ubiquitin.png width caption Crystal structure of the yeast ubiquitin activating enzyme E1 ubiquitin complex. ref name pmid18662542 PDB 3CMM cite journal author Lee I, Schindelin H title Structural insights into E1 catalyzed ubiquitin activation ... July pmid 18662542 doi 10.1016 j.cell.2008.05.046 url ref Ubiquitin activating enzymes , also known ... via a proteasome . This covalent attachment of ubiquitin or ubiquitin like proteins to targeted ... name Schulman cite journal author Schulman BA, Harper JW title Ubiquitin like protein activation by E1 ... by post transcriptional modification by ubiquitin and ubiquitin like proteins. ref name Schulman Overview of ubiquitination ubiquitylation Ubiquitin activating enzyme E1 starts the ubiquitination process Figure 1 . The E1 enzyme along with ATP binds to the ubiquitin protein. The E1 enzyme then passes the ubiquitin protein to a second protein, called Ubiquitin carrier or Ubiquitin conjugating enzyme conjugation protein E2 . The E2 protein complexes with an Ubiquitin ligase Ubiquitin protein ligase E3 . This Ubiquitin protein ligase recognizes which protein needs to be tagged and catalyzes the transfer of ubiquitin to that protein. This pathway repeats itself until the target protein has a full chain of ubiquitin attached to itself. ref name Lecker cite journal author Lecker SH, Goldberg AL, Mitch WE title Protein degradation by the ubiquitin proteasome pathway in normal and disease states ... cascade, the E1 enzyme Figure 2 binds ATP Mg sup 2 sup and ubiquitin and catalyses ubiquitin C terminal acyl adenylation. ref name Zeynep cite journal author Tokg z Z, Bohnsack RN, Haas AL title Pleiotropic effects of ATP.Mg2 binding in the catalytic cycle of ubiquitin activating ... enzyme attacks the ubiquitin AMP complex through acyl substitution, simultaneously creating ...   more details



  1. Prokaryotic ubiquitin-like protein

    Prokaryotic ubiquitin like protein Pup functional analog of ubiquitin found in prokaryote Mycobacterium tuberculosis . ref name Pup paper Cite pmid 18832610 ref Serves the same function, although the enzymology of ubiquitylation and pupylation is different. In contrast to the three step reaction of ubiquitylation, pupylation requires two steps, therefore only two enzymes are involved in pupylation. Similar to ubiquitin, Pup attaches to specific lysine residues of substrate proteins by forming isopeptide bonds to target the proteins for proteasomal degradation. Therefore, like eukaryotes, bacteria may use a small protein modifier to control protein stability. Pfam box Symbol Pup Name Pup like protein family image Pup prokaryotic ubiquitin like protein.png width 375px caption Three Prokaryotic ubiquitin like proteins blue attached to proteasomal ATPase Mpa red Pfam PF05639 InterPro SMART EntrezGene EU914921 Prosite SCOP TCDB OPM family OPM protein PDB PDB2 3M91 , PDB2 3M9D Pup gene encode a 64 amino acid protein with a molecular size of 6.944 Atomic mass unit kDa align left style border color 338899 border style solid border width 2px margin top 1em MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ clear References reflist See also Ubiquitin SUMO protein Category Proteins ...   more details



  1. Ubiquitin carboxy-terminal hydrolase L1

    . ref cite journal author Gong B title Ubiquitin hydrolase Uch L1 rescues beta amyloid induced decreases ... family whose products hydrolyze small C terminal adducts of ubiquitin to generate the ubiquitin ... cite web title Entrez Gene UCHL1 ubiquitin carboxyl terminal esterase L1 ubiquitin thiolesterase url ... journal PLoS Computational Biology date 2006 09 15 pmid 16978047 pmc 1570178 ref Interactions Ubiquitin ... ref See also UCHL3 Ubiquitin carboxyl terminal esterase L3 the gene UCHL3 References reflist Further ... Jo l cite journal author Edwards YH title The gene for human neurone specific ubiquitin C terminal hydrolase ... first6 I. N. M. cite journal author Honor B, Rasmussen HH, Vandekerckhove J, Celis JE title Neuronal ... 9.5 PGP9.5 , a neuron specific ubiquitin C terminal hydrolase journal Biochem. J. volume 268 issue ... by ubiquitin C terminal hydrolases identification of two active site residues journal Biochemistry ... CN, Krantz BA, Wilkinson KD title Substrate specificity of deubiquitinating enzymes ubiquitin ... doi 10.1021 bi972274d cite journal author Leroy E title The ubiquitin pathway in Parkinson s disease ... MH title Intron exon structure of ubiquitin c terminal hydrolase L1 journal DNA Res. volume ... S title Low frequency of pathogenic mutations in the ubiquitin carboxy terminal hydrolase gene in familial ... BS title The Ile93Met mutation in the ubiquitin carboxy terminal hydrolase L1 gene is not observed ... title Intragenic deletion in the gene encoding ubiquitin carboxy terminal hydrolase in gad mice journal ... last9 Ichihara first9 Nobutsune cite journal author Mellick GD, Silburn PA title The ubiquitin carboxy ... and shows a tight intermolecular interaction with ubiquitin in Lewy bodies journal Acta ... PDB Gallery geneid 7345 External links MeshName Ubiquitin Carboxy Terminal Hydrolase Esterases PBB ...   more details



  1. Small ubiquitin-related modifier 1

    PBB geneid 7341 Small ubiquitin related modifier 1 is a protein that in humans is encoded by the SUMO1 ... RK, Chen DJ title UBL1, a human ubiquitin like protein associating with human RAD51 RAD52 proteins ... encodes a protein that is a member of the SUMO small ubiquitin like modifier protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post translational modification system. However, unlike ubiquitin, which targets proteins for degradation, this protein ... doi 10.1016 j.tig.2007.09.002 url ref Interactions Small ubiquitin related modifier 1 has been shown ... journal last Gong first L authorlink coauthors Li B, Millas S, Yeh E T year 1999 month April title ... and Hantaan hantaviruses with small ubiquitin like modifier 1 related molecules journal Virus ... Primo year 2002 month March title Modification of the human thymine DNA glycosylase by ubiquitin ... Gregg B, Topaloglou Thodoros, Figeys Daniel year 2007 month title Large scale mapping of human protein ... journal last Liou first M L authorlink coauthors Liou H C year 1999 month April title The ubiquitin ... by the sentrin family of ubiquitin like proteins journal J. Biol. Chem. volume 273 issue 6 pages ... ubiquitin like protein which interacts with the PML component of a multiprotein complex that is disrupted ... cite journal author Matunis MJ, Coutavas E, Blobel G title A novel ubiquitin like modification ... al. title A small ubiquitin related polypeptide involved in targeting RanGAP1 to nuclear pore complex ... by a novel ubiquitin like molecule journal J. Biol. Chem. volume 272 issue 22 pages 14001 4 year ... 10.1083 jcb.140.2.259 pmc 2132567 cite journal author Howe K, Williamson J, Boddy N, et al. title The ubiquitin ... journal author Bayer P, Arndt A, Metzger S, et al. title Structure determination of the small ubiquitin ... 9885291 doi cite journal author Chen A, Mannen H, Li SS title Characterization of mouse ubiquitin ... author Liou ML, Liou HC title The ubiquitin homology protein, DAP 1, associates with tumor necrosis ...   more details



  1. Ubiquitin carboxyl-terminal hydrolase L5

    Wikify date February 2012 PBB geneid 51377 Ubiquitin carboxyl terminal hydrolase isozyme L5 is an enzyme that in humans is encoded by the UCHL5 gene . ref name pmid10810093 cite journal author Lai CH, Chou CY, Ch ang LY, Liu CS, Lin W title Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics journal Genome Res volume 10 issue 5 pages 703 13 year 2000 month Aug pmid 10810093 pmc 310876 doi 10.1101 gr.10.5.703 ref ref name pmid16027725 cite journal author Wicks SJ, Haros K, Maillard M, Song L, Cohen RE, Dijke PT, Chantry A title The deubiquitinating enzyme UCH37 interacts with Smads and regulates TGF beta signalling journal Oncogene volume 24 issue 54 pages 8080 4 year 2005 month Dec pmid 16027725 pmc doi 10.1038 sj.onc.1208944 ref ref name entrez cite web title Entrez Gene UCHL5 ubiquitin carboxyl terminal hydrolase L5 url http www.ncbi.nlm.nih.gov sites entrez?Db gene&Cmd ShowDetailView&TermToSearch 51377 accessdate ref The PBB Summary template is automatically maintained by Protein Box Bot. See Template PBB Controls to Stop updates. PBB Summary section title summary text References reflist Further reading refbegin 2 PBB Further reading citations cite journal author Maruyama K, Sugano S title Oligo capping a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. journal Gene volume 138 issue 1 2 pages 171 4 year 1994 pmid 8125298 doi 10.1016 0378 1119 94 90802 8 cite journal author Suzuki Y, Yoshitomo Nakagawa K, Maruyama K, et al. title Construction and characterization of a full length enriched and a 5 end enriched cDNA library. journal Gene volume 200 issue 1 2 pages 149 56 year 1997 pmid 9373149 doi 10.1016 S0378 1119 97 00411 3 cite journal author Hu RM, Han ZG, Song HD, et al. title Gene expression profiling in the human hypothalamus pituitary adrenal axis and full length cDNA cloning. journal Proc. Natl. Acad. Sci. U.S.A. volume 97 issue 17 pages 9543 8 year 2000 pmid ...   more details



  1. Ubiquitin A-52 residue ribosomal protein fusion product 1

    cite web title Entrez Gene UBA52 ubiquitin A 52 residue ribosomal protein fusion product 1 url http ... updates. PBB Summary section title summary text Ubiquitin is a highly conserved nuclear and cytoplasmic ..., and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus ... doi 10.1139 o95 101 cite journal author Murphey RK, Godenschwege TA title New roles for ubiquitin ... The human ubiquitin 52 residue ribosomal protein fusion gene subfamily UbA52 is composed primarily ... 10.1016 S0888 7543 05 80258 7 cite journal author Baker RT, Board PG title The human ubiquitin 52 amino ..., expression, and processing of human ubiquitin carboxyl extension proteins. journal J. Biol. Chem ... Staats BM, Simmons JG, et al. title Nucleotide sequence analysis of a cDNA encoding human ubiquitin reveals that ubiquitin is synthesized as a precursor. journal J. Biol. Chem. volume 260 issue 12 pages ... encoding a human homolog of yeast ubiquitin 1. journal Nucleic Acids Res. volume 15 issue 13 pages ... class of ubiquitin binding proteins. journal J. Biol. Chem. volume 271 issue 34 pages 20235 7 year 1996 ... Cruz C, Ventura F, Bartrons R, Rosa JL title HERC3 binding to and regulation by ubiquitin. journal ... 1 cite journal author Lee TA, Tyers M title Ubiquitin junction, what s your function? journal Genome ... N, Horman A, Woodman P title Mammalian class E vps proteins recognize ubiquitin and act in the removal of endosomal protein ubiquitin conjugates. journal J. Cell Biol. volume 157 issue 1 pages 91 101 ...   more details



  1. B+

    B may refer to B , a blood type B grade , an academic grade B tree , a data structure BBC Micro Hardware features B 64 and B 128 BBC Micro model B , a British home computer dab ...   more details



  1. B-

    B may refer to B , a blood type B grade , an academic grade B L , pronounced bee minus ell is the difference between the baryon number B and the lepton number L disambiguation ...   more details



  1. /b/

    pp move indef pp semi indef b may refer to Voiced bilabial plosive IPA b code b code , the name of 4chan b imageboard the random board on 4chan and other imageboard websites disambiguation ...   more details



  1. B?

    Unreferenced date December 2009 B sub 0 sub , that is B subscript zero , is also generally used in Magnetic Resonance Imaging to denote the net magnetization vector . Although in physics and mathematics the notation to represent a physical quantity can be arbitrary, it is generally accepted in the literature, such as the International Society for Magnetic Resonance in Medicine that B sub 0 sub represents net magnetization. This is particularly prominent in areas of science where magnetic fields are important such as spectroscopy . By convention, B sub 0 sub is interpreted as a vector geometric vector quantity pointing the z direction, with subsequent x and y cartesian coordinate system cartesian axes oriented with the right hand rule . B sub 0 sub is also the symbol often used to denote the reference magnetization in which equations with electromagnetic fields are normalized. DEFAULTSORT B0 Category Magnetic resonance imaging ...   more details



  1. A to the B

    Infobox single See Wikipedia WikiProject Songs Name A to the B Cover A to the B.jpg Artist Infernal Danish band Infernal from Album From Paris to Berlin album From Paris to Berlin Released 6 March 2006 small AUS small Format CD single CD Recorded 2004 Genre Pop music Pop Dance music Dance Length 3 36 Label Writer Producer Niels Ekner, Jesper Green, Lars Bo Kujahn, Guldhammer small executive producer executive small Certification Last single Cheap Trick Kinda Girl br 2005 This single A to the B br 2006 Next single Ten Miles br 2006 Misc A to the B is a single by Denmark Danish dance music dance house music house duo Infernal Danish band Infernal from the album From Paris to Berlin album From Paris to Berlin . Released in the beginning of 2006, the single peaked at number 3 in Denmark , Citation needed date April 2009 number 49 on the France French singles chart and number 53 in Australia . Citation needed date April 2009 Music video The music video of A to the B illustrates the fictional character, Superman played by Paw Lagermann flying through the air. At the beginning, he is seen trying to seduce some dancing women, but this seems to fail. We then see a different woman, wearing a wolfskin standing at the top of a skyscraper we assume this to be Superman s lover played by Lina Rafn ... preparing to take a shower. Track listings CD single Finland A to the B radio edit 3 38 A to the B extended version 6 14 CD single EU A to the B radio edit 3 37 A to the B extended version 6 15 A to the B Cato Azul remix 6 43 A to the B Asle s Full Blown vocal mix 5 57 CD single 2 EU A to the B radio edit 3 37 A to the B extended version 6 15 A to the B Cato Azul remix 6 43 A to the B Asle s Full ... s title Infernal A To The B publisher danishcharts.com date accessdate 2011 08 20 ref align left Ultratop ... showitem.asp?key 192269&cat s title Infernal A To The B publisher lescharts.com date accessdate ...&cat s archivedate 19 July 2011 DASHBot deadurl no ref References Reflist Infernal DEFAULTSORT A To The B ...   more details



  1. B*

    about a search algorithm variant of B Tree B tree graph search algorithm In computer science , B pronounced B star is a best first search best first graph search algorithm that finds the least cost path from a given initial node graph theory node to any goal node out of one or more possible goals . First published by Hans Berliner in 1979, it is related to the A search algorithm . Summary The algorithm stores intervals for nodes of the tree graph theory tree as opposed to single point valued estimates. Then, leaf nodes of the tree can be searched until one of the top level nodes has an interval which is clearly best. Details Interval evaluations rather than estimates Leaf nodes of a B tree are given evaluations that are intervals rather than single numbers. The interval is supposed to contain the true value of that node. If all intervals attached to leaf nodes satisfy this property, then B will identify an optimal path to the goal state. Backup process To back up the intervals within the tree ... might supply these bounds. Termination of search B systematically expands nodes in order to create separation ... with extensive evidence, like the intervals of root nodes. Expansion B is a best first process, which ... the interval , then B might not be able to identify the correct path. However, the algorithm is fairly ... of B when evaluation errors are possible. If a search terminates due to separation then Maven ... progressively widens the tree, eventually erasing all errors. Extension to two player games The B algorithm ... Andrew Palay applied B to chess. Endpoint evaluations were assigned by performing null move searches ... engines running on the same hardware. The Maven Scrabble program applied B search to endgames. Endpoint ... the gold standard for endgame analysis. The B search algorithm has been used to compute ... last Berliner title The B Tree Search Algorithm. A Best First Proof Procedure. journal Artificial Intelligence ... 2002 doi 10.1016 S0004 3702 01 00166 7 See also B tree DEFAULTSORT B Search Algorithm Category Graph ...   more details



  1. B-And-B

    About the British sitcom B&B disambiguation B&B Infobox Television show name B And B image caption genre Situation comedy Sitcom runtime 30 minutes creator Michael Pertwee starring Bernard Braden br Barbara Kelly Br Kim Braden BR Mark Griffith country United Kingdom network BBC first aired 7 June last aired 18 December 1968 num episodes 7 B And B was a United Kingdom British British sitcom sitcom starring Bernard Braden , his wife Barbara Kelly and their daughter Kim Braden . It was written by Michael Pertwee , and aired for a pilot and one series in 1968. Cast Bernard Braden Bernie Barbara Kelly Barbara Kim Braden Sally Mark Griffith Johnny Pauline Collins Chantal pilot Plot This domestic sitcom stars married couple Bernard Braden and Barbara Kelly as a married couple who both have successful showbusiness careers, and clearly there was an ounce of realism in the programme. In the pilot, Bernie falls for Chantal, their France French au pair. Bernie thinks his wife is having an affair, they both think their children are taking drugs and in the final episode the couple contemplate divorce. Episodes Pilot 1968 Pilot 7 June 1968 part of Comedy Playhouse Series One 1968 No Son of Mine 13 November 1968 Episode Two 20 November 1968 Episode Three 27 November 1968 Episode Four 4 December 1968 Episode Five 11 December 1968 Pryde and Prejudice 18 December 1968 References Mark Lewisohn , Radio Times Guide to TV Comedy , BBC Worldwide Ltd, 2003 http www.phill.co.uk comedy bandb index.html British TV Comedy Guide for B And B External links Imdb title 0247856 B And B British Comedy Guide sitcom sitcoms b and b.shtml B And B DEFAULTSORT B And B Category 1968 television series debuts Category 1968 television series endings Category 1968 in British television Category 1960s British television series Category BBC television sitcoms Category Comedy Playhouse Category Lost BBC episodes ...   more details



  1. Vitisin B

    Vitisin B may refer to Vitisin B pyranoanthocyanin Vitisin B stilbenoid See also Vitisin disambiguation Chemistry disambiguation ...   more details



  1. B-Sides

    B Sides may refer to B Sides The Enemy album B Sides Smile Empty Soul EP B Sides Helix album B Sides Slade album B Sides Danko Jones album B Sides Damien Rice album See also B Sides and Rarities , several albums B Side album , compilation album by Mr. Children A side and B side List of B side compilation albums disambig ...   more details



  1. Company B

    Company B may refer to Company B band a dance pop trio. Company B album , Company B s 1987 debut album. Company B theatre a theatre company. Company B A marketing and Public Relations firm in Milwaukee, WI. Company B A modern piece by American choreographer Paul Taylor disambig ...   more details



  1. B-flat

    B flat or B music flat may refer to B flat major B flat minor The musical pitch B musical note B music flat B flat Jazzclub Jazzclub in Berlin, Germany disambig Long comment to avoid being listed on short pages ...   more details



  1. B (disambiguation)

    wiktionarypar B B is the second letter of the Latin alphabet. B may also refer to TOC right Science and technology B battery, a battery used to provide the plate voltage of a Battery vacuum tube B battery vacuum tube Haplogroup B mtDNA , a human mitochondrial DNA mtDNA haplogroup Haplogroup B Y DNA , a Y chromosomal DNA Y DNA haplogroup B, Blood type ATC code B Blood and blood forming organs , a section of the Anatomical Therapeutic Chemical Classification System Boron , a chemical element B, B and B ... speed setting B horizon , a layer of soil commonly known as subsoil Astronomy B, abbreviation for astronomical objects in the List of dark nebulae Barnard objects Barnard list of dark nebulae b represents ... one of the reciprocal lattice vectors b breadth b , see length impact parameter b molality b barn unit b , a unit of area magnetic field B napierian absorbance B rigid rotor rotational constant B second virial coefficient B susceptance B Music, education and religion B musical note B I Am Kloot album B I Am Kloot album , a compilation album by Manchester band I Am Kloot B grade , for evaluation ... Sancti Pauli , a religious order abbreviated to the postnominal B. music flat Flat music , a note lower in pitch by a semitone b, an Iamamiwhoami song Charly B born 1981 , stage name of reggae singer songwriter Charles Blanvillain Computing and internet B programming language B Method , for computer software development b, bit Abbreviation symbol bit B, Byte Abbreviation Symbol byte B tree , a data structure code nowiki b nowiki code , an HTML element denoting bold text code b code , the name of 4chan b imageboard the random board on 4chan and other imageboard websites Linguistics Voiced bilabial plosive IPA b Publishing the Baltimore Sun b newspaper , a free daily, tabloid sized newspaper ... Rules football B, often used after the name of football clubs to denote a reserve team Transportation B New York City Subway service B Buenos Aires Subway service B S train See also Decibel ...   more details




Articles 1 - 25 of 451779          Next


Search   in  
Search for Ubiquitin B in Tutorials
Search for Ubiquitin B in Encyclopedia
Search for Ubiquitin B in Videos
Search for Ubiquitin B in Books
Search for Ubiquitin B in Software
Search for Ubiquitin B in DVDs
Search for Ubiquitin B in Store


Advertisement




Ubiquitin B in Encyclopedia
Ubiquitin B top Ubiquitin B

Home - Add TutorGig to Your Site - Disclaimer

©2011-2013 TutorGig.info All Rights Reserved. Privacy Statement