|
Armadillo repeat containing X-linked 6 is a protein that in humans is encoded by the ARMCX6 gene located on the X-chromosome.[1] It is one of six armadillo repeats containing X-linked proteins (ARMCX1, ARMCX2, ARMCX3, ARMCX4, ARMCX5, and ARMCX6 (this protein)). The function of this protein is unknown at this time. Protein sequence This is a diagonal plot of the protein displaying internal repeats. 1 MGRAREVGWM AAGLMIGAGA CYCVYKLTIG RDDSEKLEEE 41 GEEEWDDDQE LDEEEPDIWF DFETMARPWT EDGDWTEPGA 81 PGGTEDRPSG GGKANRAHPI KQRPFPYEHK NTWSAQNCKN 121 GSCVLDLSKC LFIQGKLLFA EPKDAGFPFS QDINSHLASL 161 SMARNTSPTP DPTVREALCA PDNLNASIES QGQIKMYINE 201 VCRETVSRCC NSFLQQAGLN LLISMTVINN MLAKSASDLK 241 FPLISEGSGC AKVQVLKPLM GLSEKPVLAG ELVGAQMLFS 301 FMSLFIRNGN REILLETPAP Homology ARMCX6 is conserved in many eukaryotic organisms. Orthologs Secondary Structure The secondary structure of ARMCX6 is predicted to be similar to cyanase. A comparison of the two sequences is shown below.[2][3] 10 20 30 40 ....*....|....*....|....*....|....*....|....*.. ARMCX6 231 MLAKSASDLKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQM 277 1DW9_A 19 LLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARLVGAKL 65 + + ++ + + + + + + + + + + ++++ Cyanase segment having identity with ARMCX6. Expression Microarray data show that ARMCX6 is highly expressed during earliest stages of spermatogenesis in mice. [4][5][6] References Further reading
|